PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000187872
Common NameMYB3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 294aa    MW: 32217 Da    PI: 7.8938
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000187872genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.47.9e-191560147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+++Ede+l + v+++G ++W+ I++ ++ gR++k+c++rw + 
    MDP0000187872 15 KGPWSPDEDEKLRQIVQRYGARNWSVISKSVP-GRSGKSCRLRWCNQ 60
                     79******************************.***********985 PP

2Myb_DNA-binding56.47e-1869111347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEde+++ a++++G++ W+tIar ++ gRt++ +k++w++ 
    MDP0000187872  69 AFTPEEDEIIAGAHAKYGNK-WATIARLLN-GRTDNAIKNHWNST 111
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.6451065IPR017930Myb domain
SuperFamilySSF466891.15E-3112108IPR009057Homeodomain-like
SMARTSM007174.6E-161463IPR001005SANT/Myb domain
PfamPF002499.4E-191560IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-251667IPR009057Homeodomain-like
CDDcd001671.30E-151759No hitNo description
SMARTSM007175.1E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129419.73967116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.8E-2368115IPR009057Homeodomain-like
PfamPF002494.2E-1569111IPR001005SANT/Myb domain
CDDcd001671.40E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MESSAMVQRE LDRVKGPWSP DEDEKLRQIV QRYGARNWSV ISKSVPGRSG KSCRLRWCNQ  60
LSPEVEHRAF TPEEDEIIAG AHAKYGNKWA TIARLLNGRT DNAIKNHWNS TLKRKFSALS  120
PNEDGATIDE GILRPEKKAA TAAVSFSGLC YSPGSPSGSD VSESDVPASS SSQVFRPVAR  180
TAAIVTRESP PSQTEWCEPS TLLTLSLPGA ESALHELPTN ESAPHRGQRT ASLQPEKETN  240
VNNSNTMSFG PEFMSVMQEM IRKEVRSYME GAACSQGEGV RNAGVKRIGI SRLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-40141163105C-Myb DNA-Binding Domain
1msf_C2e-40141163105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.170800.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008373085.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW13e-84MYB44_ARATH; Transcription factor MYB44
TrEMBLD9ZJ570.0D9ZJ57_MALDO; MYB domain class transcription factor
STRINGVIT_03s0180g00210.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-79myb domain protein 73